CAS Number: 86168-78-7 Molecular Weight: 3355.82 Salt Form: TFA Purity: >96% Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 Storage: -20 °C or below
Growth Hormone Releasing Factor (GHRF or GRF) is a peptide that stimulates the release of growth hormone via GPCR receptor GHRH-R. N-terminal fragments and modified fragments are used to study the biological roles of GHRF.