CAS Number: 114547-31-8Molecular Weight: 3162.6Salt Form: TFAPurity: >96%Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2Storage: -20 °C or below
Galanin is a non-selective agonist that binds the GAL1, GAL2, and GAL3 receptors and inhibits cAMP production. It has been shown to be an anticonvulsant in rats that prevents fully kindled seizures.
Categories | Peptides |
---|
Filter | Metabolic / Diabetes, Neuropeptides & Hormones |
---|