CAS Number: 106612-94-6Molecular Weight: 3355.73Salt Form: AcetatePurity: >96%Sequence (3-letter): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHSequence (1-letter): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OHStorage: -20 °C or below
Glucagon-like Peptide-1 (7-37) is one the two primary biologically active forms of secreted glucagon-like peptide-1 (GLP-1). GLP-1 is secreted as a pro-pepetide that is then proteolytically cleaved into two active forms, (7-37) and (7-36). These active peptides can promote insulin secretion in a glucose-dependent manner.
Categories | Peptides |
---|
Filter | Metabolic / Diabetes, Neuropeptides & Hormones |
---|