CAS Number: 88813-36-9Molecular Weight: 3208.63Salt Form: TFAPurity: >96%Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2Storage: -20 °C or below
Galanin is a neuropeptide first isolated from the porcine small intestine. It has a variety of biologic effects in the digestive system via the GAL1-3 receptors, including inhibiting the secretion of somatostatin, insulin, and glucose.
Categories | Peptides |
---|
Filter | Neuropeptides & Hormones |
---|