Molecular Weight: 3328.73Salt Form: TFAPurity: >95%Sequence (3-letter): Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2Sequence (1-letter): SNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2Storage: -20 °C or below
Calcitonin is cyclic peptide hormone that stimulates bone formation by osteoblasts and inhibits bone resorption. Calcitonin is a hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of non-mammalian vertebrates. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Salmon calcitonin is more potent than mammalian forms. Calcitonin, salmon [Des-Cys1] is an analog in which the N-terminal Cys has been replaced with Ser.
Categories | Peptides |
---|
Filter | Calcitonin Gene Peptides |
---|